Domain: tiger-web1.srvr.media3.us TIL there is one enigma message that has never been broken | O-T Lounge
Started By
Message
locked post

TIL there is one enigma message that has never been broken

Posted on 6/27/23 at 9:53 am
Posted by stout
Porte du Lafitte
Member since Sep 2006
181317 posts
Posted on 6/27/23 at 9:53 am
JCRSAJTGSJEYEXYKKZZSHVUOCTRFRCRPFVYPLKPPLGRHVVBBTBRSXSWXGGTYTVKQNGSCHVGF

It is a radio message from U-534







LINK
Posted by Tbonepatron
Member since Aug 2013
8462 posts
Posted on 6/27/23 at 9:54 am to
Wait till you hear about the LIGMA code….
Posted by FenrirTheBeard
NOLA
Member since Jun 2012
6796 posts
Posted on 6/27/23 at 9:54 am to
It translates to:

IAMJEFFREYEPSTEINANDIDIDNTKILLMYSELF
Posted by RummelTiger
Official TD Sauces Club Member
Member since Aug 2004
93473 posts
Posted on 6/27/23 at 9:54 am to
Give me about 30 minutes on the toilet and i'll have that broken.
Posted by Shexter
Prairieville
Member since Feb 2014
20161 posts
Posted on 6/27/23 at 9:55 am to
I got this: Meyer Offerman is really Wilhelm Zuchs, aka The Wolf

quote:

U534

Bild "The U534 messages:U534_k.jpg"
U 534 at Birkenhead Docks German submarine U-534 was a Type IXC/40 U-boat of the Nazi German Kriegsmarine built for service during World War II. She was built in 1942 in Hamburg-Finkenwerder by Deutsche Werft AG as 'werk' 352. She was launched on 23 September 1942 and commissioned on 23 December with Oberleutnant Herbert Nollau in command.
The U-boat is one of only four German WWII submarines in preserved condition remaining in the world, the only other IXC boat being U-505 in Chicago, USA. This boat was used mainly for training duties, and during her life sank no other ships. A Royal Air Force bomber sank her on 5 May 1945 in the Kattegat some 20 kilometers northeast of the Danish island of Anholt. U-534 was salvaged in 1993 and since February 2009 has been on display in Birkenhead as part of the U-boat Story. From Wikipedia, the free encyclopedia.

There are rumors about irregular ENIGMA machines used on U 534. We disproved this: All messages decrypts on standard M4 machines.

Bild "Enigma Printer"
Enigma Schreibmax deviceSome M4 Enigmas used the Schreibmax, a small printer that could print the 26 letters on a narrow paper ribbon. This eliminated the need for a second operator to read the lamps and transcribe the letters. The Schreibmax was placed on top of the Enigma machine and was connected to the lamp panel. To install the printer, the lamp cover and light bulbs had to be removed. It improved both convenience and operational security. From Wikipedia, the free encyclopedia. Picture: Ben Slivka CC BY-SA 3.0

Bild "Enigma paper strip Schreibmax"
Schreibmax paper strip U534There is a clue that the radio operators from U534 used a "Schreibmax" printer device for the Enigma M4 machine. On the left hand side you can see a printed paper strip. It contains plaintext from Message P1030660. Maybe this is the reason, why there is no hand written plaintext on the most of the U 534 cipher forms.
This post was edited on 6/27/23 at 9:59 am
Posted by 777Tiger
Member since Mar 2011
91055 posts
Posted on 6/27/23 at 9:55 am to
U-2?
Posted by Signal Soldier
30.411994,-91.183929
Member since Dec 2010
8583 posts
Posted on 6/27/23 at 9:56 am to
Posted by SixthAndBarone
Member since Jan 2019
10992 posts
Posted on 6/27/23 at 9:56 am to
Let AI do it's job.
Posted by teke184
Zachary, LA
Member since Jan 2007
103546 posts
Posted on 6/27/23 at 9:57 am to
Why couldn’t they break it? The radio guy forgot to put HH at the end?
Posted by LittleJerrySeinfield
350,000 Post Karma
Member since Aug 2013
11199 posts
Posted on 6/27/23 at 10:05 am to
TL/DD
Posted by Saint Alfonzo
Member since Jan 2019
29782 posts
Posted on 6/27/23 at 10:18 am to
It says "Epstein didn't kill himself."
Posted by CocomoLSU
Inside your dome.
Member since Feb 2004
156173 posts
Posted on 6/27/23 at 10:19 am to
quote:

one E Nigma

Posted by kaleidoscoping
Washington state
Member since Feb 2021
445 posts
Posted on 6/27/23 at 10:54 am to
Tell me your a redditor without telling me your a redditor /s
Posted by Chicken
Jackassistan
Member since Aug 2003
27401 posts
Posted on 6/27/23 at 10:55 am to
quote:

Give me about 30 minutes on the toilet and i'll have that broken
the message or the toilet?
Posted by soccerfüt
Location: A Series of Tubes
Member since May 2013
74137 posts
Posted on 6/27/23 at 11:05 am to
quote:

JCRSAJTGSJEYEXYKKZZSHVUOCTRFRCRPFVYPLKPPLGRHVVBBTBRSXSWXGGTYTVKQNGSCHVGF
”Oh ihr von wenig Glauben. Skenes wird gegen die Alligatoren nicht benötigt. Gehen Tiger!”

(Oh ye of little faith. Skenes will not be needed against the Gators. Geaux Tigers!”)
Posted by LSUWoodworker
St George "God's Country "
Member since Dec 2007
18755 posts
Posted on 6/27/23 at 11:21 am to
"We operated this sub with a Nintendo controller"
Posted by RummelTiger
Official TD Sauces Club Member
Member since Aug 2004
93473 posts
Posted on 6/27/23 at 11:21 am to
quote:

the message or the toilet?


Yes.
Posted by Skunk Baxter
Annandale
Member since Nov 2020
15 posts
Posted on 6/27/23 at 11:57 am to
It looks like they still haven’t found what they’re looking for.
Posted by 777Tiger
Member since Mar 2011
91055 posts
Posted on 6/27/23 at 11:58 am to
quote:

It looks like they still haven’t found what they’re looking for.



did they check beneath the Joshua Tree?
Posted by IonaTiger
The Commonwealth Of Virginia
Member since Mar 2006
33261 posts
Posted on 6/27/23 at 12:01 pm to
Well played 777.
first pageprev pagePage 1 of 2Next pagelast page

Back to top
logoFollow TigerDroppings for LSU Football News
Follow us on X, Facebook and Instagram to get the latest updates on LSU Football and Recruiting.

FacebookXInstagram